Full Text Available
Note: Clicking the button above will open the full text document at the original institutional repository in a new window.
The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review
Background: Tuberculous pericardial effusion is a pro-fibrotic condition that is complicated by constrictive pericarditis in 4-8% of cases. N-acetyl-seryl-aspartyl-lysylproline (Ac-SDKP) is a ubiquitous tetrapeptide with antifibrotic properties that is low in tuberculous pericardial effusion, thus p...
Saved in:
| Main Author: | |
|---|---|
| Other Authors: | |
| Format: | Thesis |
| Language: | English |
| Published: |
Department of Medicine
2016
|
| Subjects: | |
| Tags: |
No Tags, Be the first to tag this record!
|
| _version_ | 1867613255385481216 |
|---|---|
| access_status_str | Open Access |
| author | Mnguni, Ayanda Trevor |
| author2 | Engel, Mark E |
| author_browse | Engel, Mark E Mnguni, Ayanda Trevor |
| author_facet | Engel, Mark E Mnguni, Ayanda Trevor |
| author_sort | Mnguni, Ayanda Trevor |
| collection | Thesis |
| description | Background: Tuberculous pericardial effusion is a pro-fibrotic condition that is complicated by constrictive pericarditis in 4-8% of cases. N-acetyl-seryl-aspartyl-lysylproline (Ac-SDKP) is a ubiquitous tetrapeptide with antifibrotic properties that is low in tuberculous pericardial effusion, thus providing a potential mechanism for the heightened fibrotic state. Angiotensin converting enzyme inhibitors (ACEI), which increase Ac-SDKP levels with antifibrotic effects in animal models, are candidate drugs for preventing constrictive pericarditis if they can be shown to have similar effects on AcSDKP and fibrosis in human tissues. Objective: To systematically review the effects of ACEIs on Ac-SDKP levels in human tissues. Methods: We searched five electronic databases (1996-2014) and conference abstracts with no language restrictions. Two reviewers independently selected studies, extracted data and assessed methodological quality. The protocol was registered in PROSPERO. |
| format | Thesis |
| id | oai:open.uct.ac.za:11427/19896 |
| institution | University of Cape Town (South Africa) |
| language | eng |
| last_indexed | 2026-06-10T12:33:13.838Z |
| license_str | Not specified — see source repository |
| provenance_str_mv | Harvested via OAI-PMH from UCTD — University of Cape Town Open Access Repository |
| publishDate | 2016 |
| publishDateRange | 2016 |
| publishDateSort | 2016 |
| publisher | Department of Medicine |
| publisherStr | Department of Medicine |
| record_format | dspace |
| source_str | UCTD — University of Cape Town Open Access Repository |
| spelling | oai:open.uct.ac.za:11427/19896 The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review Mnguni, Ayanda Trevor Engel, Mark E Mayosi, Bongani M Medicine Background: Tuberculous pericardial effusion is a pro-fibrotic condition that is complicated by constrictive pericarditis in 4-8% of cases. N-acetyl-seryl-aspartyl-lysylproline (Ac-SDKP) is a ubiquitous tetrapeptide with antifibrotic properties that is low in tuberculous pericardial effusion, thus providing a potential mechanism for the heightened fibrotic state. Angiotensin converting enzyme inhibitors (ACEI), which increase Ac-SDKP levels with antifibrotic effects in animal models, are candidate drugs for preventing constrictive pericarditis if they can be shown to have similar effects on AcSDKP and fibrosis in human tissues. Objective: To systematically review the effects of ACEIs on Ac-SDKP levels in human tissues. Methods: We searched five electronic databases (1996-2014) and conference abstracts with no language restrictions. Two reviewers independently selected studies, extracted data and assessed methodological quality. The protocol was registered in PROSPERO. 2016-06-02T08:47:20Z 2016-06-02T08:47:20Z 2015 Master Thesis Masters MMed http://hdl.handle.net/11427/19896 eng application/pdf Department of Medicine Faculty of Health Sciences University of Cape Town |
| spellingShingle | Medicine Mnguni, Ayanda Trevor The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review |
| thesis_degree_str | Master's |
| title | The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review |
| title_full | The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review |
| title_fullStr | The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review |
| title_full_unstemmed | The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review |
| title_short | The effects of angiotensin converting enzyme inhibitors (ACEI) on human N-acetylseryl-aspartyl-lysyl-proline (AcSDKP) levels : a systematic review |
| title_sort | effects of angiotensin converting enzyme inhibitors acei on human n acetylseryl aspartyl lysyl proline acsdkp levels a systematic review |
| topic | Medicine |
| url | http://hdl.handle.net/11427/19896 |
| work_keys_str_mv | AT mnguniayandatrevor theeffectsofangiotensinconvertingenzymeinhibitorsaceionhumannacetylserylaspartyllysylprolineacsdkplevelsasystematicreview AT mnguniayandatrevor effectsofangiotensinconvertingenzymeinhibitorsaceionhumannacetylserylaspartyllysylprolineacsdkplevelsasystematicreview |